PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.103470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 304aa    MW: 33844.8 Da    PI: 6.9041
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.103470.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ q+G+g +W + ++++g++R++k+c++rw++yl
   Cucsa.103470.1 14 KGPWSPEEDAKLKAYIDQFGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.84.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.103470.1  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.112962IPR017930Myb domain
SuperFamilySSF466893.68E-2611109IPR009057Homeodomain-like
SMARTSM007177.4E-121364IPR001005SANT/Myb domain
PfamPF002491.6E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241569IPR009057Homeodomain-like
CDDcd001673.66E-91662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.0E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2370117IPR009057Homeodomain-like
CDDcd001672.00E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYID QFGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QQQAVAARRI PPLKKDDFDK NFNNIIHPSS SLNLNNYEAP YIPNLSTSTQ DHQVRDLILK  180
MGGNPMENQN PLLFQSSNFG ELNMEFGASN DGIFHGSVDQ NSSGGGEFGD PIMLENFENG  240
LVEDFNNYGM MPSSSTSGES SYSLGEISSL GFNYSDFEAS QHQHHHHVIA PAFAHQSTHY  300
SLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8850850.0KT885085.1 Cucumis sativus cultivar TH169 1-aminocyclopropane-1-carboxylate synthase, hypothetical protein, DNA binding / transcription factor, and branched-chain amino acid aminotransferase genes, complete cds.
GenBankKT8850860.0KT885086.1 Cucumis sativus cultivar WDSGD 1-aminocyclopropane-1-carboxylate synthase, hypothetical protein, DNA binding / transcription factor, and branched-chain amino acid aminotransferase genes, complete cds.
GenBankKT8850870.0KT885087.1 Cucumis sativus cultivar WFEJ 1-aminocyclopropane-1-carboxylate synthase, hypothetical protein, DNA binding / transcription factor, and branched-chain amino acid aminotransferase genes, complete cds.
GenBankKT8850880.0KT885088.1 Cucumis sativus cultivar WJE F11 1-aminocyclopropane-1-carboxylate synthase, hypothetical protein, DNA binding / transcription factor, and branched-chain amino acid aminotransferase genes, complete cds.
GenBankKT8850890.0KT885089.1 Cucumis sativus cultivar TH118FLM 1-aminocyclopropane-1-carboxylate synthase, hypothetical protein, DNA binding / transcription factor, and branched-chain amino acid aminotransferase genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657912.10.0PREDICTED: transcription factor RAX2-like
TrEMBLV4SFN34e-89V4SFN3_9R
STRINGPOPTR_0002s11440.12e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.19e-78myb domain protein 84